PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_23360A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 132aa    MW: 14202.1 Da    PI: 9.7915
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_23360AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53e-0892121332
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmg 32 
                                +WT+eE+  ++ + ++lG+g+W+  +++++
  Oropetium_20150105_23360A  92 PWTEEEHRTFLAGLEKLGKGDWRVTSAKLP 121
                                8*********************97666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.09885131IPR017877Myb-like domain
SuperFamilySSF466892.03E-686115IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-788114IPR006447Myb domain, plants
PfamPF002496.8E-692121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-792122IPR009057Homeodomain-like
CDDcd001673.41E-692122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MPRDSRPAGM RLFGVTIAPA PEADAPDRDL SPNPPLAARE DVMRKCKSMC NLAAAGASMD  60
GSAAADGYLS DDGLMQSSGK RRRAQERKKA VPWTEEEHRT FLAGLEKLGK GDWRVTSAKL  120
PHITTPRDKN A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9619181e-49EU961918.1 Zea mays clone 239020 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676506.16e-59PREDICTED: putative MYB DNA-binding domain superfamily protein isoform X1
TrEMBLC4J0127e-59C4J012_MAIZE; MYB-related transcription factor
STRINGGRMZM2G157306_P022e-57(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58583652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-15MYB_related family protein